Protein Info for GFF4714 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Nitrite-sensitive transcriptional repressor NsrR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00738: Rrf2 family protein
  • amino acids 2 to 130 (129 residues), 110 bits, E=4e-36
• PF02082: Rrf2
  • amino acids 3 to 130 (128 residues), 126.4 bits, E=4.3e-41

Best Hits

Swiss-Prot: 49% identical to NSRR_BACSU: HTH-type transcriptional regulator NsrR (nsrR) from Bacillus subtilis (strain 168)

KEGG orthology group: K13771, Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor (inferred from 67% identity to lch:Lcho_1476)

Predicted SEED Role

"Nitrite-sensitive transcriptional repressor NsrR" in subsystem Nitrosative stress or Oxidative stress or Rrf2 family transcriptional regulators

Protein Sequence (148 amino acids)

>GFF4714 Nitrite-sensitive transcriptional repressor NsrR (Hydrogenophaga sp. GW460-11-11-14-LB1)
VRLTTMTDYALRLLMYLAQQPDRLCTIAEAAQAHGISETHLMKVTHHLGLLGWIETVRGK
GGGMRLARAPHEIGLGEVVRDMEPDFHLVECFSSGNTCVRTGDCALTGVLQSALQDFLAR
LDGVTLADIVPARPLPATRVAVHRVAVR