Protein Info for GFF4712 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 144 to 171 (28 residues), see Phobius details PF04982: HPP" amino acids 65 to 180 (116 residues), 128.9 bits, see alignment E=1.2e-41 PF00571: CBS" amino acids 242 to 294 (53 residues), 56.6 bits, see alignment 2.6e-19 amino acids 325 to 380 (56 residues), 42.1 bits, see alignment 9.1e-15

Best Hits

KEGG orthology group: K07168, CBS domain-containing membrane protein (inferred from 67% identity to aav:Aave_0890)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>GFF4712 Probable transmembrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
LNPDGQPSVARVERATRFLAAFWPAPVRVDAHERWRSVAGAGLGILFTALLSRWWAGANA
MGPWLVAPLGASAVLVFALPASPMAQPWSVVGGNTLSALVGAACAMLVPDPAWAAALAVA
AAIGLMFALRCLHPPGGATALLTSLGAVGFHFAAFPMFVNSLLLVVAGVVYNSLSGRRYP
HAQVRAPHEPTAAPARFSAADLDAALAHYNQVLDVSRDDLEELLHHAESAAYQRNFGSLR
CGDIMTPEPIAVSFGTPLREAWGLMRQHRIKALPVVDRARRIVGIVTVSDFMRHAELDRH
EGIGDRFRALMRRSGTVHSDKPEVVGQLMTREVRVASINRHVSELVPLFSEGGHHHIPII
DTERRLAGIITESDLVRALHRVARPAD