Protein Info for GFF4712 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Formate hydrogenlyase subunit 7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF01058: Oxidored_q6" amino acids 48 to 157 (110 residues), 97.4 bits, see alignment E=2.8e-32

Best Hits

Swiss-Prot: 97% identical to HYCG_ECOLI: Formate hydrogenlyase subunit 7 (hycG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to cro:ROD_30921)

MetaCyc: 97% identical to hydrogenase 3 iron-sulfur protein HycG (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase subunit 7" in subsystem Formate hydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF4712 Formate hydrogenlyase subunit 7 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSNLLGPRDANGIPVPMTVDESIASMKASLLKNIKRSAYVYRVDCGGCNGCEIEIFATLS
PLFDAERFGIKVVPSPRHADILLFTGAVTRAMRSPALRAWQSAPDPKICISYGACGNSGG
IFHDLYCVWGGTDKIVPVDVYIPGCPPTPAATLYGFAMALGLLEQKIHARAPGELDDQPA
EILHPDMVQPLRVKVDRAARRLAGYRYGRQIADDYLTQLGQGEQQVARWLEAENDPRLTE
IVTHLNHVVEEARIR