Protein Info for GFF471 in Sphingobium sp. HT1-2

Annotation: Uncharacterized amino acid permease, GabP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 92 to 118 (27 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 278 to 303 (26 residues), see Phobius details amino acids 331 to 349 (19 residues), see Phobius details amino acids 353 to 377 (25 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 19 to 387 (369 residues), 152 bits, see alignment E=2.5e-48 PF00324: AA_permease" amino acids 28 to 401 (374 residues), 112.9 bits, see alignment E=1.6e-36

Best Hits

KEGG orthology group: K03759, arginine:agmatine antiporter (inferred from 80% identity to sch:Sphch_2946)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>GFF471 Uncharacterized amino acid permease, GabP family (Sphingobium sp. HT1-2)
MDSPPPAQDVIPHRPVRTLGLAACIALVMGNMIGSGVFLLPAALAPFGWDAVAAWVFTIA
GSLILAFVIARLTVAMPDANAAQMSARAYGPLAGFAIGWIYWLSIIITNVTIAVAATANL
SSLLPALNRPGMGALCSIGFIWLTTAINLRGAHAAGTAQLVTTIIKVIPILVVLVLLALT
IGRGTAEIVPFPAQGFTGSGITAAAALTLWALLGFESASVAADKVKDPARTVPRATMIGT
AVTGLLYLFVCSGIALTLPGAESQTGSPFGAYVTHYWSAGPASLIATFVVISCLGALNGW
TLLQGEVPLAMARAGELPAWLAGTDARGTPVRGLILSSILASLLLVANSLQGLVALFTAM
ALLATSATLWLYVGCALAALRLRIALPAAAIGLAYACWTLWGAGLIPSGASFLLMAGGLP
FYWWARRTSATP