Protein Info for GFF4709 in Xanthobacter sp. DMC5

Annotation: Galactose-proton symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 45 to 63 (19 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 237 to 261 (25 residues), see Phobius details amino acids 273 to 297 (25 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 332 to 356 (25 residues), see Phobius details amino acids 368 to 388 (21 residues), see Phobius details amino acids 394 to 418 (25 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 10 to 429 (420 residues), 286.8 bits, see alignment E=1.5e-89 PF00083: Sugar_tr" amino acids 11 to 431 (421 residues), 307.4 bits, see alignment E=1.9e-95 PF07690: MFS_1" amino acids 12 to 284 (273 residues), 76.8 bits, see alignment E=1.5e-25 amino acids 251 to 427 (177 residues), 33.8 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: None (inferred from 80% identity to xau:Xaut_0826)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>GFF4709 Galactose-proton symporter (Xanthobacter sp. DMC5)
MATLFLTAGLVLLNGMLFGFSTASIAGVVGTISEAFALSTRATEMMVTSLLAGCFVGAVL
AAPISQRIGRRPSCLLAATLAFAGYALVPLGQAMAPGVGMLVAARILIGLGVGLSSMVVP
MYAAEVTPARHRGAVVSLFQLAVTIGILLGYAVPLALTGHATWAQMLGGGVLIAAACAGA
VLLLPESPRWLISRGRIVEGEAAAQRLGLAGEISVGEGESAPAGNWRAVLGRGSTKAVLV
LCSVLFVLQNFSGIDGILYYAPHIFTELGFPAGVAALAATFGLGLVNVLATMAAMMLVDR
LGRRPLLIAGSAAMAVSLALVIVAALADWPYVALAGLCAYIVAFALSLGPLPYVLMSELF
PSAIRERGIAAASATSWLFNAIVAASFLSVVEGIGLAATIGIFLVVCVASLFISLAYVPE
TRQVELEDIEKDVLAGKALRRLGA