Protein Info for GFF4707 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 242 to 265 (24 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 30 to 379 (350 residues), 138 bits, see alignment E=4.4e-44 PF01061: ABC2_membrane" amino acids 194 to 345 (152 residues), 45.3 bits, see alignment E=7.6e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>GFF4707 ABC-type multidrug transport system, permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
VETATNATGLGPVVRREWQRLRHDAWDLGMLTWIPLGVCLLIWWMFAAGIARDLPIVVID
RDQSSLSRSLLRMVDESPGVRVAAAVGNEAEATAWLRERRAYGLLVVPASFQHDIGAGRS
ATVSWFYNGQFSVHAGGLTRDVRTAVSTLSAGIEMTARGKRGASAAQAAEQFEPIRLRLG
TLYNENANYESFLVLALIPSMLQIFVALAAITAVGRELRAGSVPQWLASAGGRWHTAVAG
KLVIPAAAFAVQAVLFVVFFGFVRGWAIEGSGLMIVAGLWLLIAAYLGLGLLMIAVTLTL
RNALSAAAFVTAPAFAFSGQGYPLSAMPALARAWAEALPLTHYLQLQGKHWLAGAPWTYG
VGDALVLLGFAVVSGGAGLLILKQRAGQASAWGRT