Protein Info for GFF4705 in Sphingobium sp. HT1-2

Annotation: Haloacid dehalogenase, type II (EC 3.8.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF00702: Hydrolase" amino acids 6 to 197 (192 residues), 57.1 bits, see alignment E=5.2e-19 TIGR01428: haloacid dehalogenase, type II" amino acids 7 to 207 (201 residues), 147.7 bits, see alignment E=4.2e-47 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 95 to 194 (100 residues), 57.3 bits, see alignment E=2.4e-19 PF13419: HAD_2" amino acids 104 to 203 (100 residues), 28.6 bits, see alignment E=2.2e-10 PF13242: Hydrolase_like" amino acids 160 to 231 (72 residues), 22.8 bits, see alignment E=1e-08

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 72% identity to bma:BMAA0223)

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.- or 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>GFF4705 Haloacid dehalogenase, type II (EC 3.8.1.2) (Sphingobium sp. HT1-2)
MILKGVRALVFDVFGTLVDWRGGVAREVAPFLRRYEVACDPAEFADAWRRRYSPSMEEVR
SGRRPFTRLDVLHRENLELTLLDVGLDPETIPSSEIDALNMAWHKLDPWPDVVSGLRRLK
SGFIIAPLSNGNISLMIDIARRSNLPWDAILGAEVARAYKPTPEAYLRTAEILGMRPDEV
CLVAAHNSDLLAARNCGFRTACVPRITEHGPKQTSDLSAEQDWDFVAKDLEAFADVLDT