Protein Info for GFF4704 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Anaerobic nitric oxide reductase flavorubredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF00753: Lactamase_B" amino acids 33 to 174 (142 residues), 53.6 bits, see alignment E=7.4e-18 PF19583: ODP" amino acids 35 to 228 (194 residues), 66.2 bits, see alignment E=9.7e-22 PF12706: Lactamase_B_2" amino acids 45 to 148 (104 residues), 27.2 bits, see alignment E=6.9e-10 PF00258: Flavodoxin_1" amino acids 256 to 389 (134 residues), 68 bits, see alignment E=2.6e-22 PF00301: Rubredoxin" amino acids 425 to 471 (47 residues), 72.4 bits, see alignment 6e-24

Best Hits

Swiss-Prot: 100% identical to NORV_SALTY: Anaerobic nitric oxide reductase flavorubredoxin (norV) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K12264, anaerobic nitric oxide reductase flavorubredoxin (inferred from 100% identity to stm:STM2840)

MetaCyc: 93% identical to anaerobic nitric oxide reductase flavorubredoxin (Escherichia coli K-12 substr. MG1655)
1.18.98.-

Predicted SEED Role

"Anaerobic nitric oxide reductase flavorubredoxin" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>GFF4704 Anaerobic nitric oxide reductase flavorubredoxin (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSILVKNNIHWVGQRDWEVRDFHGTEYKTLRGSSYNSYLIREEKNVLIDTVDHKFSREFV
QNLRSEIDLADIDYIIINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGHHHHPEWN
FKVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYMTGDAVLFSNDAFGQHYCDERLFND
EVDQTELFEQCQRYYANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVE
LYLKWATDYQEDRITIFYDTMSNNTRMMADAIAQGINEVDPNVAVKIFNVARSDKNEILT
NVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLRFRNKRASAFGSHGWSGGAVDRLSTRL
QDAGFEMSLSLKAKWRPDLDALELCRQHGRDIARQWALAPLPETTQQIAPVEETITCTAA
DLGPKMQCSVCQWIYDPALGEPLQDVAPGTPWNDVPDNFLCPECSLGKDVFDVLATEAK