Protein Info for GFF4703 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Anaerobic nitric oxide reductase transcription regulator NorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 PF01590: GAF" amino acids 22 to 154 (133 residues), 50.5 bits, see alignment E=9.8e-17 PF13185: GAF_2" amino acids 25 to 155 (131 residues), 29.4 bits, see alignment E=2.5e-10 PF00158: Sigma54_activat" amino acids 187 to 353 (167 residues), 228.3 bits, see alignment E=1.4e-71 PF14532: Sigma54_activ_2" amino acids 188 to 358 (171 residues), 81.1 bits, see alignment E=2.9e-26 PF00004: AAA" amino acids 211 to 343 (133 residues), 21.4 bits, see alignment E=9.1e-08

Best Hits

Swiss-Prot: 100% identical to NORR_SALSV: Anaerobic nitric oxide reductase transcription regulator NorR (norR) from Salmonella schwarzengrund (strain CVM19633)

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 99% identity to sek:SSPA2511)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (506 amino acids)

>GFF4703 Anaerobic nitric oxide reductase transcription regulator NorR (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSFSVEVLAGIAIELQRGIGHQDRFQRLITTLRQVLACDASALLRYESRQFIPLAIDGLA
QDVLGRRFTLEGHPRLEAIARAGDVVRFPADSDLPDPYDGLIPGQESLKVHACVGLPLFA
GQNLIGALTLDAMTPEQFEVFSDEELRLVAALAAGALSNALLIEQLESQNMLPGSSGVFE
PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLV
YLNCAALPESVAESELFGHVKGAFTGAISNRSGKFEMADNGTLFLDEIGELSLALQAKLL
RVLQYGDIQRVGDDRSLRVDVRVLAATNRDLREEVLAGRFRADLFHRLSVFPLFVPPLRE
RGDDVVLLAGYFCEQCRLRLGLSRVVLSPGARRHLLNYGWPGNVRELEHAIHRAVVLARA
TRAGDEVILEAQHFALSEDVLPAPPAESFLALPTCRNLRESTENFQREMIRQALAQNNHN
WAASARALETDVANLHRLAKRLGLKD