Protein Info for GFF4700 in Xanthobacter sp. DMC5

Annotation: Selenide, water dikinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 TIGR00476: selenide, water dikinase" amino acids 16 to 325 (310 residues), 410.9 bits, see alignment E=1.7e-127 PF00586: AIRS" amino acids 58 to 165 (108 residues), 88.9 bits, see alignment E=3.1e-29 PF02769: AIRS_C" amino acids 178 to 353 (176 residues), 69 bits, see alignment E=5.5e-23

Best Hits

Swiss-Prot: 69% identical to SELD_METSB: Selenide, water dikinase (selD) from Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)

KEGG orthology group: K01008, selenide, water dikinase [EC: 2.7.9.3] (inferred from 85% identity to xau:Xaut_0666)

Predicted SEED Role

"Selenide,water dikinase (EC 2.7.9.3)" in subsystem Selenocysteine metabolism (EC 2.7.9.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.9.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>GFF4700 Selenide, water dikinase (Xanthobacter sp. DMC5)
MLDVPHASPQDQAPVRLTSLAHGGGCGCKLAPSVLQELLAGQASGGPFERLLVGTETGDD
AAAYDLDGETAIIATTDFFMPMVDDPDHFGRIAATNAISDVYAMGGEPLMALAILGMPLG
KIDTATVRAILAGGQAICAEAGIPVAGGHSIDCPEPVYGLAVIGRAPKARLRRNSTARVG
DALILTKALGVGVYSAAFKKEALSAAAYDEMIASVTKLNRVGAALGKEAAVSAITDVTGF
GILGHGLEMARGSGAILVIERAALPWLSEAQMLVQQGFVTGASHRNWASYGAEVDLPEGT
PDWQRHLFTDPQTSGGLLVACAPEEADRLLADIRAAGYPAAVRIGRVEAGPGRVRIVG