Protein Info for GFF4700 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: tRNA-specific adenosine-34 deaminase (EC 3.5.4.-) / domain of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 PF14437: MafB19-deam" amino acids 43 to 189 (147 residues), 132.6 bits, see alignment E=1.9e-42 PF00383: dCMP_cyt_deam_1" amino acids 43 to 141 (99 residues), 104.1 bits, see alignment E=6.9e-34 PF00561: Abhydrolase_1" amino acids 246 to 479 (234 residues), 81.5 bits, see alignment E=1.6e-26 PF12697: Abhydrolase_6" amino acids 246 to 487 (242 residues), 56.6 bits, see alignment E=1.2e-18

Best Hits

KEGG orthology group: None (inferred from 74% identity to pol:Bpro_2447)

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-) / domain of unknown function" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>GFF4700 tRNA-specific adenosine-34 deaminase (EC 3.5.4.-) / domain of unknown function (Hydrogenophaga sp. GW460-11-11-14-LB1)
VAARPAHEPVSLQHAARTPSPYFTGWAPALTYTRRMPDTPAPDDARFMRLALAEAQAAGQ
AGEVPVGAVVVKDGQVIATGRNAPIDGHDPTAHAEIVALRAAARALGNYRLDGCSLYVTL
EPCAMCSGAMLHARLARVVFGAADPKTGAAGSVLDLFGHAQINHQTVVQGGVLAEEGAQL
LRGFFKERRVNPHPLRDDALRTPDERFQNLPGYPWAPQYLSDLPSLGGLRLHYLDEGPKD
APLTWLCLHGNPAWSYLYRKMIPVFLGSGARVVAPDLIGFGRSDKPKKDGAHSFTWHRQV
LLELVERLDLRHVVLVVQDWGGLLGLTLPMAAPQRYRGLLVMNTTLATGEVPLSPGFLAW
RTMCAQNPEFDVARLFARGNPQMSPAECAAYNAPFPDRGHRAALRAFPPMVPEHADDDGA
AVSRQARDFWSHDWQGQSLMAIGQQDPVLGNAVMQALHAQIRHCPEPLDLPQAGHFVQEH
GQTIADAAVRHFAATTPG