Protein Info for GFF47 in Xanthobacter sp. DMC5

Annotation: Inner membrane ABC transporter permease protein YdcV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 77 to 255 (179 residues), 72.7 bits, see alignment E=1.7e-24

Best Hits

Swiss-Prot: 56% identical to POTI_ECOLI: Putrescine transport system permease protein PotI (potI) from Escherichia coli (strain K12)

KEGG orthology group: K11074, putrescine transport system permease protein (inferred from 95% identity to xau:Xaut_2943)

MetaCyc: 56% identical to putrescine ABC transporter membrane subunit PotI (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine transport system permease protein PotI (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>GFF47 Inner membrane ABC transporter permease protein YdcV (Xanthobacter sp. DMC5)
MRKGLTWFNVTSIVLGFAFLYIPIILLVIYSFNASRLVTVWAGFSTQWYWSLLENEQLID
AAWVTLRIAFFSSLVATVLGTMAALALTRYGRFGGRTLFSGMIYAPLVMPEVITGLSLLL
LFVAVNFDRGFWTVLLAHITFTMCFVAVVVQSRLVTFDRTLEEAALDLGCPPFQTFFKIT
LPLILPAVVSGFMLAFTLSLDDLVIASFTTGPGATTLPMRIYSQVRLGVTPEINAVCTIL
IAIVTVVVIVASIVTKRAENQRQAEERAALQ