Protein Info for GFF4697 in Sphingobium sp. HT1-2

Annotation: Plasmid replication protein RepA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF10609: ParA" amino acids 102 to 244 (143 residues), 28.9 bits, see alignment E=2.4e-10 PF13614: AAA_31" amino acids 102 to 266 (165 residues), 114.5 bits, see alignment E=1.7e-36 PF09140: MipZ" amino acids 102 to 148 (47 residues), 22.9 bits, see alignment 1.5e-08 PF01656: CbiA" amino acids 103 to 340 (238 residues), 65.3 bits, see alignment E=1.6e-21 PF02374: ArsA_ATPase" amino acids 109 to 242 (134 residues), 33.8 bits, see alignment E=6.7e-12 PF00142: Fer4_NifH" amino acids 109 to 159 (51 residues), 28.2 bits, see alignment 4.1e-10

Best Hits

KEGG orthology group: None (inferred from 39% identity to aex:Astex_3569)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>GFF4697 Plasmid replication protein RepA (Sphingobium sp. HT1-2)
MLSGQILDTMITSCENAKSVLRRAAIDPSDRKTLSITMGASVAAEFLGRTPEALAKAEAR
GRLPAPKTANNGRRFYTVEDLIAIREALGIKAGKLPDERAVVVAVQNFKGGVSKSTTSKH
LADYLALRGYRVLVVDCDPQASMSVMFDVNLEELVEETHTLSNYLSPRIDEADSFRKTIK
PTAWPNIDICPANLGLQDTEWELTATIEEGPHAIAGAFRMLRVGLEEVRHDYDVIILDPP
PAMGFLGVNTLSAADGLLIPVPARQLDYLSTIHFMQTCREAMSLVSKFDNSIDYGFIRVV
CTMFQPNRTNEAQMLQVMEKTYAGQMLSTPILLSEEIKNAGIAMSSIYEINKPYGSHQTY
TRCRDNLNAVFKELEKDICKQWPSRLAQLGTDRLTEAA