Protein Info for GFF4697 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PTS system, glucitol/sorbitol-specific IIB component and second of two IIC components (EC 2.7.1.69)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 151 to 169 (19 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details TIGR00825: PTS system, glucitol/sorbitol-specific, IIBC component" amino acids 3 to 323 (321 residues), 615.2 bits, see alignment E=1.3e-189 PF03612: EIIBC-GUT_N" amino acids 4 to 175 (172 residues), 225.8 bits, see alignment E=3.6e-71 PF07663: EIIBC-GUT_C" amino acids 230 to 322 (93 residues), 146.9 bits, see alignment E=1.7e-47

Best Hits

Swiss-Prot: 92% identical to PTHB_ECOLI: PTS system glucitol/sorbitol-specific EIIB component (srlE) from Escherichia coli (strain K12)

KEGG orthology group: K02782, PTS system, glucitol/sorbitol-specific IIB component [EC: 2.7.1.69] K02783, PTS system, glucitol/sorbitol-specific IIC component (inferred from 99% identity to seg:SG2736)

MetaCyc: 92% identical to sorbitol-specific PTS enzyme IIBC1 component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-169 [EC: 2.7.1.198]; TRANS-RXN-156 [EC: 2.7.1.198, 2.7.1.197]

Predicted SEED Role

"PTS system, glucitol/sorbitol-specific IIB component and second of two IIC components (EC 2.7.1.69)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.197 or 2.7.1.198 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>GFF4697 PTS system, glucitol/sorbitol-specific IIB component and second of two IIC components (EC 2.7.1.69) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTRVRIEKGAGGWGGPLELDVTPDKKIVYITAGTRPAIVDKLAQLTGWQAVDGFKEGEPP
EAEIGAAIIDCGGTLRCGIYPKRRIPTINIHSTGKSGPLAQYIVEDIYVSGVKEENITLV
GETPASPQPAKTTLGRDYDTSKKITEQSDGLLAKVGMGMGSAVAVLFQSGRDTIDTVLKT
ILPFMAFVSALIGIIMASGLGDWIAHGLAPLASHPLGLVTLALICSFPLLSPFLGPGAVI
AQVIGVLIGVQIGLGNIPPHLALPALFAINAQAACDFIPVGLSLAEAKQDTVRVGVPSVL
VGRFLTGAPTVLIAWFVSGFIYQ