Protein Info for GFF4695 in Xanthobacter sp. DMC5

Annotation: Formate dehydrogenase-O iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01582: formate dehydrogenase, beta subunit
  • amino acids 21 to 301 (281 residues), 467.5 bits, E=6.3e-145
• PF12800: Fer4_4
  • amino acids 47 to 60 (14 residues), 17 bits, see alignment (E = 2.8e-06)
  • amino acids 143 to 157 (15 residues), 15.7 bits, see alignment (E = 7.4e-06)
• PF12838: Fer4_7
  • amino acids 48 to 126 (79 residues), 33.2 bits, E=2.7e-11
• PF13247: Fer4_11
  • amino acids 104 to 200 (97 residues), 77.8 bits, E=2.8e-25
• PF12837: Fer4_6
  • amino acids 137 to 159 (23 residues), 27.4 bits, see alignment (E = 1.1e-09)
• PF00037: Fer4
  • amino acids 139 to 159 (21 residues), 27.1 bits, see alignment (E = 1.2e-09)
• PF09163: Form-deh_trans
  • amino acids 258 to 301 (44 residues), 63.6 bits, 5.3e-21

Best Hits

Swiss-Prot: 59% identical to FDOH_SHIFL: Formate dehydrogenase-O iron-sulfur subunit (fdoH) from Shigella flexneri

KEGG orthology group: None (inferred from 89% identity to xau:Xaut_0661)

MetaCyc: 59% identical to formate dehydrogenase O subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase O beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• nitrate reduction III (dissimilatory) (2/2 steps found)
• formate oxidation to CO₂ (1/1 steps found)
• formate to dimethyl sulfoxide electron transfer (1/2 steps found)
• formate to trimethylamine N-oxide electron transfer (1/2 steps found)
• superpathway of C1 compounds oxidation to CO₂ (8/12 steps found)
• oxalate degradation VI (2/4 steps found)
• formate to nitrite electron transfer (1/3 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• oxalate degradation III (2/5 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Protein Sequence (318 amino acids)

>GFF4695 Formate dehydrogenase-O iron-sulfur subunit (Xanthobacter sp. DMC5)
MFPPIPNPTTAPVAPKMSDADLVRRSASGSPSQVEFKEPVAKLIDVSKCIGCKACQSACL
EWNELHEEIGTFNGTYTNPPDLTPASLTLMRFTEWVNPETDNLEWLIRKDGCMHCADPGC
LKACPAPGAIVQYSNGIVDFDHAKCIGCGYCVKGCPFNIPRISQVDHKAYKCTLCSDRVA
VGQGPACQKACPTQAIVFGTKTQMKQWAEGRIKDLKSRGYKNAGLYDPPGVGGTHVMYVL
QHADKPSIYAGLPDNPRISPIVEAWKGVTKYVGLGVMGFAALAGALHYLVNGANKVSPED
EANAEKLTAEKLSSGGRS