Protein Info for GFF4695 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13406: SLT_2
  • amino acids 57 to 351 (295 residues), 307.7 bits, E=3.9e-96
• TIGR02282: lytic murein transglycosylase B
  • amino acids 61 to 353 (293 residues), 425.2 bits, E=5.8e-132

Best Hits

Swiss-Prot: 92% identical to MLTB_ECOLI: Membrane-bound lytic murein transglycosylase B (mltB) from Escherichia coli (strain K12)

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 100% identity to sty:STY2952)

MetaCyc: 92% identical to membrane-bound lytic murein transglycosylase B (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]; 4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

MetaCyc Pathways

• peptidoglycan recycling I (14/14 steps found)
• peptidoglycan recycling II (7/10 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 4.2.2.f

Protein Sequence (359 amino acids)

>GFF4695 Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFKRRYVALLPLCVLLAACSSTPKSSETQATTGTPSGGFLLEPQHNVMQMGGDFANNPNA
QQFIDKMVSKHGFDRQQLQEILSQSKRLDYVLRLMDRQAPTTQPPAGPNGAWLRYRKQFI
TPDNVQNGVAFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRIMGKTRILDALATLS
FNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKEYAVDFNGDG
HINLWDPVDAIGSVANYFKAHGWVKGDMVAVPASGQAPGLANGFKTKYSISQLAAAGLTP
QQSLGNHQEASLLRLDIGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVR