Protein Info for GFF4693 in Xanthobacter sp. DMC5

Annotation: Protein FdhE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR01562: formate dehydrogenase accessory protein FdhE" amino acids 25 to 320 (296 residues), 304.7 bits, see alignment E=4.5e-95 PF04216: FdhE_N" amino acids 38 to 200 (163 residues), 162.5 bits, see alignment E=1.7e-51 PF24859: FdhE_central" amino acids 203 to 241 (39 residues), 54.9 bits, see alignment 1.2e-18 PF24860: FdhE_C" amino acids 242 to 318 (77 residues), 90.3 bits, see alignment E=1.1e-29

Best Hits

KEGG orthology group: K02380, FdhE protein (inferred from 70% identity to xau:Xaut_0659)

Predicted SEED Role

"formate dehydrogenase formation protein FdhE" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF4693 Protein FdhE (Xanthobacter sp. DMC5)
VHVTREVREVIMSRTFGPSSAPPIPDPSVLEGVTAPTFAYLPDPSALFARRAARFRHLAQ
NNPLAPYLTFLAGLSEAQHAAIAATPAPEPVEVAQVERARANEMPPLDRSHFTTDAAFDT
LFERALAEATKIEQPEAARTALERVRMASDVARGEMIRNVLASSIPEEALAEHLYVAAAL
EAHFARLASQLDAARLVPVGDGVCPTCGGPPVGSLIVNWPTSHGARYCACALCGTLWNYV
RVRCTACGSTAGIGYQEMEGGNGAVKAETCDTCHAYSKVFYLTQDDGLDPVADDVASLAL
DIKQKDGPYRRAAFNPFLLGY