Protein Info for PS417_24010 in Pseudomonas simiae WCS417

Annotation: dihydropteroate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01496: dihydropteroate synthase
  • amino acids 24 to 278 (255 residues), 323.6 bits, E=5.4e-101
• PF00809: Pterin_bind
  • amino acids 25 to 264 (240 residues), 273.4 bits, E=1e-85

Best Hits

Swiss-Prot: 60% identical to DHPS_SHIFL: Dihydropteroate synthase (folP) from Shigella flexneri

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 98% identity to pfs:PFLU5259)

MetaCyc: 60% identical to dihydropteroate synthase (Escherichia coli K-12 substr. MG1655)
Dihydropteroate synthase. [EC: 2.5.1.15]

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

• superpathway of chorismate metabolism (44/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• tetrahydrofolate biosynthesis II (2/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Sequence Analysis Tools

See A0A1N7UHI6 at UniProt or InterPro

Protein Sequence (283 amino acids)

>PS417_24010 dihydropteroate synthase (Pseudomonas simiae WCS417)
MTSVLSSTRLPCGNRVLDLAHTHVMGILNVTPDSFSDGGRFSQLDAALRHAEAMVAAGAT
LIDVGGESTRPGARVVSPLEELERVAPIVERIARELDVIISVDTSTPAVMRETARLGAGL
INDVRSLQRDGALDAAAATGLPVCLMHMLGEPGNMQDSPHYDDLVGEVSGFLAERVAQCA
VAGIAAEKIILDPGFGFAKTLQHNLSLFKHMESLHALGRPLLVGVSRKSMIGLALNRPVG
ERLYGGLALAALAVTKGARILRVHDVAETVDVVRMIAAVESAE