Protein Info for GFF4691 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00497: SBP_bac_3" amino acids 46 to 271 (226 residues), 208.8 bits, see alignment E=7.4e-66 PF10613: Lig_chan-Glu_bd" amino acids 90 to 138 (49 residues), 31.5 bits, see alignment 1.7e-11

Best Hits

Swiss-Prot: 46% identical to HISJ_SALTY: Histidine-binding periplasmic protein (hisJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10022, arginine/ornithine transport system substrate-binding protein (inferred from 76% identity to rfr:Rfer_1525)

Predicted SEED Role

"Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein" in subsystem Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>GFF4691 Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKNLFLSLSLIGAAALVGCGKTEAPAPAAPAAAPAAAPAPAEMPELKVAIDPTYEPFTFK
TADGKPTGFDVDIADALCAQIKRKCVYVEQVWDSMIPGLQAKKYDAIISSMSITEERLQV
VDFTDKYYFTPSRIVVKTGTAYTDPASLKGKKIGVLKGSTQEKYAMGELKPAGVSIVPYE
AQDQVYLDIKSGRLDGTVADQVEVNGGFLRKPEGAGYGFVGPVLNEAKYYGTGVGVALRK
GETALKDELNAAIKAIRSNGVYETVAKKYFDFDVYGN