Protein Info for GFF469 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 259 to 287 (29 residues), see Phobius details amino acids 299 to 324 (26 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 310 (260 residues), 137.6 bits, see alignment E=2.2e-44

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 57% identity to axy:AXYL_05219)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF469 hypothetical protein (Xanthobacter sp. DMC5)
MASIEAKTGSMTHSRLPRRGLSRHARLALVWLALAAVPFVVPNAYWISLANLALINLVLI
ASLNLLMGYGGQISLAHAGFFGLGAYASGILNVRYGLPPWAGLPAAAVVAGLGALLIGIP
ALRLRGHYLAMATLGWNAILVVFFTQLVGLTGGPNGLLGVEPFSIFGHALDTEAKAFPLA
WAVAFLVMLAISNLLASRIGRSIRAVATNELGAQSLGIGSFRTKLAVFVLSAGMAGIAGS
LYVHINQYASPETFGIAPSIMLLVMVAIGGAGTFYGPMLGALIYTAVPQILLDYEDAELM
LFGLGLLVVLILFPRGLAGIPAALASLVRRRWP