Protein Info for GFF469 in Sphingobium sp. HT1-2

Annotation: 3-methylmercaptopropionyl-CoA dehydrogenase (DmdC)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 transmembrane" amino acids 520 to 537 (18 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 81 to 157 (77 residues), 44.3 bits, see alignment E=5.5e-15 PF02770: Acyl-CoA_dh_M" amino acids 163 to 271 (109 residues), 46.5 bits, see alignment E=8.6e-16 PF00441: Acyl-CoA_dh_1" amino acids 282 to 451 (170 residues), 61.2 bits, see alignment E=3.3e-20 PF22924: ACOX_C_alpha1" amino acids 302 to 446 (145 residues), 31.8 bits, see alignment E=3.1e-11 PF12806: Acyl-CoA_dh_C" amino acids 474 to 593 (120 residues), 127.2 bits, see alignment E=1e-40

Best Hits

KEGG orthology group: None (inferred from 85% identity to sjp:SJA_C1-09690)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (600 amino acids)

>GFF469 3-methylmercaptopropionyl-CoA dehydrogenase (DmdC) (Sphingobium sp. HT1-2)
MPSYNAPVRDTRFVLDHVVGLERYANLPGFENATPDLVEAILTEGGKIASEVLFPINAVG
DKEGCTRHADGSVTTPTGFKAAYDQFVEGGWTTLHAPTEFGGQGLPNVVATAVTEYVLSA
NQAFEMYHGLTAGAIAALIAKGSDEQKATYLPNMVSGVWTGTMNLTEPHSGTDLGLIKTK
AVPNGDGSFAISGTKIFISAGEHDLAENIIHLVLAKTPGAPDSSKGISLFVVPKFIVNED
GSLGDRNAVSCGSLEHKMGIHGNATCVMNYDGAKGWLVGEENKGLAAMFIMMNAARLGVG
LQGLGQGEIAFQNAVHYAKDRRQGRALTGPKEPEEKADTLFVHPDVRRMLMEGKALTEGL
RALILWGALQHDLSHSAATEEERQAADDLLQLLTPVIKGYGTDKGFDVAVSSQQVFGGHG
YIWENGVEQYVRDARIAQIYEGTNGVQAMDLVGRKLPMNGGRALQAFLKILATEIAEAKG
NEKLASFADALEKAKGQLEAATMWLMQNAMKNPDNAGAGAHHYMHILGIVATGLMWLRMA
KAATGLLDAGEGDAGFLEAKLVTARFFAERIMPDAGSLRRKIEGGADTLMALDPDMFLAA