Protein Info for GFF4689 in Sphingobium sp. HT1-2

Annotation: proton/glutamate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 302 to 320 (19 residues), see Phobius details amino acids 327 to 344 (18 residues), see Phobius details amino acids 350 to 374 (25 residues), see Phobius details PF00375: SDF" amino acids 13 to 401 (389 residues), 344.8 bits, see alignment E=3.4e-107

Best Hits

KEGG orthology group: None (inferred from 38% identity to psa:PST_0196)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>GFF4689 proton/glutamate symporter (Sphingobium sp. HT1-2)
MSTMTRRWFAIPLWLRVLGGLLAGVLTGLFWPAAIPWIGFVGELFVRLIRMLVVPIVFVS
IASGVTALADPRRLGSVGGRTVLLFAFTTACAVSIGMALGLLIGPGTGAALGKAVPHALE
EAKSLHDQLIGIVPVNIVQSLAEGDMLAIIFFAMLFGCGVILAGDEARPMANMLQSASRV
LFHLVRLVMEITPFGVLALIAKAVADNGIAVFANIGWLALCVLLGVIVQILLVHLPLIRL
VARLSIRRFFHAAVDPLLVAFSTASSAATLPVALRVAQEELQLDPAIASTVLPIGASIGK
DGTAMYVGLLSIFALQALGVHPDSTMLGIMLLTGALAAFGTAPIPSASLFMLAAVLSAVG
ISPEQTALVVGFVLPFDRLLDMTRTIASASANLAVTTAVARNDTRSNQLAFPQ