Protein Info for GFF4688 in Xanthobacter sp. DMC5

Annotation: D-alanyl-D-alanine dipeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01427: Peptidase_M15" amino acids 31 to 226 (196 residues), 153.3 bits, see alignment E=3.6e-49

Best Hits

Swiss-Prot: 45% identical to VANX_STRCO: D-alanyl-D-alanine dipeptidase (vanX) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K08641, D-alanyl-D-alanine dipeptidase [EC: 3.4.13.22] (inferred from 84% identity to xau:Xaut_0653)

MetaCyc: 40% identical to D-alanyl-D-alanine dipeptidase monomer (Enterococcus faecium)
D-Ala-D-Ala dipeptidase. [EC: 3.4.13.22]

Predicted SEED Role

"D-alanyl-D-alanine dipeptidase (EC 3.4.13.22)" (EC 3.4.13.22)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.13.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>GFF4688 D-alanyl-D-alanine dipeptidase (Xanthobacter sp. DMC5)
MDRLVKPAALALTIAGLPLAADARTDRPDLFVDVASVVPDAVFDVRYFSTDNFVGTRVDG
YGAARCFLTRPAVEALAKVAAEAKQKGLGLRIFDCYRPARAVAHFARWARDLRDEKTKPT
YYPDVAKKDLFAEGYIAARSGHSRGSTLDLTLFDLSTRRDIDMGTPFDLFSPRSWPESAA
VTAAQRANRRLLAGLMTENGFKPFDKEWWHFTLRDEPFPDTYFDFPIE