Protein Info for GFF4684 in Variovorax sp. SCN45

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 238 to 269 (32 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 314 to 338 (25 residues), see Phobius details amino acids 359 to 366 (8 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 15 to 398 (384 residues), 180 bits, see alignment E=3.4e-57

Best Hits

KEGG orthology group: None (inferred from 86% identity to vap:Vapar_3561)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>GFF4684 Na+/H+ antiporter (Variovorax sp. SCN45)
MSATSLLLQLIVILTTARVCGWVLRHVGQPSVVGEMAAGLMLGPVVFGALFPSLHAQLFS
KESLQGLSSLSTLGLVLFMFVVGLELRASKGVREQLRSAGYVGVLSVIVPLALGVAISPA
LYPTLAPAGVGFWPFALFMAAALSITAFPVMARILKDRGMTRTPFGQLSLGAAAVVDVFA
WILLAFVVALVGAGEGYQGLLKTTLGMAVVLCALFFGLKPAFAWLLRTKAPEGEPSTTVM
ASLMIGLLVTALATEWLHLHAVFGAFLFGACLPRDDRLLKSLSERIEPISIVVLMPLFFA
LAGLGTTSNAFSGAGFGAMMLILGVAAFGKIAGGAVGARMAGYGWRDSLATGSLMNARGL
MELIVMKIGLDAGLIGPELFTMLLVMALVTTAMTGPLINLFIGRRSPAVADAAHAKP