Protein Info for GFF4678 in Variovorax sp. SCN45

Annotation: FIG00348290: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 748 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 408 to 426 (19 residues), see Phobius details amino acids 432 to 450 (19 residues), see Phobius details amino acids 458 to 490 (33 residues), see Phobius details amino acids 499 to 526 (28 residues), see Phobius details amino acids 531 to 551 (21 residues), see Phobius details PF12805: FUSC-like" amino acids 87 to 322 (236 residues), 92 bits, see alignment E=3.7e-30 PF13515: FUSC_2" amino acids 420 to 542 (123 residues), 72.6 bits, see alignment E=3.5e-24

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_4103)

Predicted SEED Role

"FIG00348290: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (748 amino acids)

>GFF4678 FIG00348290: hypothetical protein (Variovorax sp. SCN45)
MVLGPRAAARVRAALRIALSHYVASGLTVALGLLFISGGVHLWLGTLAASAAATGVIVTA
PPDLPGPRRGKFFQMLPAPLIGLPLFFAVQMLHTAPIRLGLLLVPATFMAFLAMAWGKRG
IPIAIAVMFSMIFSMATQAPRDMADALERTWHFGLGAGLYAIWATLANLLLNGRFRTQSV
ADVLYSLAALMRTEAGQFLPHDDTRDVRDTPAPVLGQLLREQAALADQLQATRDIVLESP
RTPRRQRLAAMLVIVLEMRDQLLASELDLDALRAHPAHAAALIEMRQVLEELADETMALA
DALLMRRQPAAVADRRPRLAAIHVSSDDSSNGGGHIGPTAAMLARGLASRIGHINDEVLR
LSAMARGDAEPNLAVVRANWQMFVSPTDWSWRPFFTLWRWDQPPLRHAIRASLAIAAGYA
IAVSMPWGSHDYWILLTIVVVLRGSLSQTLERRNARVAGTLLGCVLAVGLLSAHPSALAL
LAIVTVAQAIAHSFAVRRYLITAVAATVLGLVQAHMLNVGVAPIFALFERIADTLIGAAL
AWGFCYVLPSWERTQIPALVARVLTAQARHARLALGLGQLQAIDSSPELEWRLARREAYD
SLSALVQATQRSLSEPRAVQPPLEPLEHLQAHSYQLLAQLSAVKSMLVLRRDRLTPGEVE
GPISRTSQRIEAAIGTMPTTGPSHPESSGSTAVGGPIPLPDPFDNDISPWLLRRLDLATA
LATQLRDDAARILQPLNETTTQAKTTTA