Protein Info for GFF4678 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 219 to 247 (29 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 404 to 429 (26 residues), see Phobius details amino acids 441 to 462 (22 residues), see Phobius details amino acids 468 to 490 (23 residues), see Phobius details

Best Hits

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (497 amino acids)

>GFF4678 hypothetical protein (Sphingobium sp. HT1-2)
MTASIAADLTEGPTPERPPLRTLGLYLLLGFSAGLPFYMFNAVLTLRLARHGIDIVIIGF
FAWIALLPTFKFVWAPLLDRYSVPGFSHFWGRRRGWIMLSQLGIFFSMVAMAFTSSDQSL
PLTALFSILLAFWTTTLEVAADGWRIELAPTQAQQGPIVAANLWGYRSAMVAAGSGAVLV
AAWADWTWAYLAIAIAAFLPFPILAAMRPEQEKTKGRTGALISGTLVSLVILAVTGAATA
LIGWVLLSAVQSAGFSAQTNVTPIVLAVALLPFVALAIALPRIRRLPADAPAKMPGFIAP
YVEIFWRYGYAVLPVLAFVSFYRMGDVLTLTLSHPLWNAAGYSLEQISMADGVVALTCSM
AGVALGGLCAARLPMTVALIIGACASAIGNWVFVWLWYAEPSAFVLYVAAGVDQFGHGLE
GAVFVVYLSMLVSPRYPGTQYAFLSGFAFLLPRLIGGAAGAIQKQIGYDGFFILSGALSF
AAIFFLPIVMRVRARTV