Protein Info for GFF4671 in Xanthobacter sp. DMC5

Annotation: UvrABC system protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 897 TIGR00631: excinuclease ABC subunit B" amino acids 100 to 751 (652 residues), 1016.3 bits, see alignment E=0 PF04851: ResIII" amino acids 109 to 233 (125 residues), 49.8 bits, see alignment E=1.3e-16 PF00270: DEAD" amino acids 112 to 178 (67 residues), 27.7 bits, see alignment 7.4e-10 PF17757: UvrB_inter" amino acids 255 to 344 (90 residues), 107.6 bits, see alignment E=9.9e-35 PF27431: UvrB_3rd" amino acids 351 to 410 (60 residues), 91.7 bits, see alignment 7.7e-30 PF00271: Helicase_C" amino acids 537 to 640 (104 residues), 69.5 bits, see alignment E=9.8e-23 PF12344: UvrB" amino acids 647 to 688 (42 residues), 76.8 bits, see alignment 3.2e-25 PF02151: UVR" amino acids 720 to 753 (34 residues), 34.2 bits, see alignment (E = 5.7e-12)

Best Hits

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 87% identity to azc:AZC_3127)

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (897 amino acids)

>GFF4671 UvrABC system protein B (Xanthobacter sp. DMC5)
MVGDRPHIPPMAKASRPGKLGERSQRHFEPAPQQALDPALAQSLGLNPGDLTVDLESAGA
SATVQALAKLIETGRPEVNGQTWVPHRPPRPEKSEGGVAFTMKSDFQPAGDQPQAIKELC
AQAEAGDRDQVLLGVTGSGKTFTMAKVIEKLQRPAIVLAPNKTLAAQLYGEFKSFFPDNA
VEYFVSYYDYYQPEAYVPRTDTYIEKESSINEQIDRMRHAATRSLLERDDVIIVASVSCI
YGIGSVETYSAMTFDIKVGERIDQRGLIADLVALQYKRIQSDFARGTFRVRGDSVEIFPA
HYEDRAWRVSLFGDEVESIAEFDPLTGQKSGDMKSVRVYAASHYVTPRPTLIQAISGIKA
ELKMRLDELYKMGRLLEAQRLEQRTRYDLEMMEATGSCAGIENYSRWLTGRKPGEPPPTL
FEYVPDNALVFIDESHVTVPQIGAMYRGDFRRKATLAEYGFRLPSCMDNRPLRFEEWEAM
RPQTVHVSATPGSWEMNQTGGVFVEQVIRPTGLIDPPVEVRPARTQVDDLLGEVRAVAAK
GYRTLVTVLTKRMAEDLTEYLHENGIRVRYMHSDIDTIERIEIIRDLRLGAFDVLIGINL
LREGLDIPECGLVAILDADKEGFLRSETSLVQTIGRAARNVDGRVVLYADHITGSMERAM
AETSRRREKQVAYNTEHGITPESVKKAIGDILNSVYERDHVQVDAGLAEEGAAFGHNLKA
VMADLEKRMRAAAADLDFETAARLRDEIRRLEATELAVSDDPLARQEAVDDRTGGYKGAR
KYGKAANLPPKEEAGRLLPRGRGKPSAKGRSAAADDEGMGEAQAPYTPPSAATPKAVRTP
AETPLAAPLSTRAHKPSLDDMGPGSDRVVPLAEDTFRPGPRPDPGTKGYRKGGRRKG