Protein Info for PS417_23900 in Pseudomonas simiae WCS417

Annotation: poly(A) polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 308 to 322 (15 residues), see Phobius details TIGR01942: poly(A) polymerase" amino acids 25 to 461 (437 residues), 632.2 bits, see alignment E=2e-194 PF01743: PolyA_pol" amino acids 56 to 189 (134 residues), 138.7 bits, see alignment E=2e-44 PF12627: PolyA_pol_RNAbd" amino acids 216 to 277 (62 residues), 71.6 bits, see alignment E=5.6e-24 PF12626: PolyA_pol_arg_C" amino acids 332 to 450 (119 residues), 147.3 bits, see alignment E=3e-47

Best Hits

Swiss-Prot: 47% identical to PCNB_HAEIN: Poly(A) polymerase I (pcnB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 99% identity to pfs:PFLU5239)

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UHH0 at UniProt or InterPro

Protein Sequence (467 amino acids)

>PS417_23900 poly(A) polymerase (Pseudomonas simiae WCS417)
MLKKLFQSFRSPLRRTQHKRSTPEVLNSSQHSLQRAQFSRYAVNIVERLQNAGYQAYLVG
GCVRDMLLNITPKDFDVATSATPEQVRAEFRNARIIGRRFKLVHIHFGREIIEVATFRAG
HPQNDEEEDTNQSSRNESGRILRDNVYGTLEEDAQRRDFTINALYYDPVSERILDYANGV
HDIRNNLIRLIGDPVQRYQEDPVRMLRAVRFAAKLNFGIERHTAAPIRELAPMLREIPSA
RLFEEVLKLFLSGYAADTFEMLVDLQLFDPLFPASAEALEYNPTYTHTLISEALINTDLR
IKQNKPVTPAFLFAALLWPALPKRVLRLQERGMPPIPAMQEAAHELIAEQCQRIAIPKRF
TMPIREIWDMQERLPRRSGKRADLLLDNPRFRAGYDFLLLRESAGEQTDGLGEWWTDYQD
ANDSGRRDMIRELGSKGDGEGAGPKKRRRSGTKRKRSSADASGAAGE