Protein Info for PS417_23875 in Pseudomonas simiae WCS417

Annotation: molecular chaperone DnaK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 TIGR02420: RNA polymerase-binding protein DksA" amino acids 28 to 136 (109 residues), 170.1 bits, see alignment E=8.4e-55 PF21157: DksA_N" amino acids 33 to 102 (70 residues), 113.6 bits, see alignment E=4e-37 PF01258: zf-dskA_traR" amino acids 106 to 138 (33 residues), 40.4 bits, see alignment 2.4e-14

Best Hits

Swiss-Prot: 74% identical to DKSA_SALTY: RNA polymerase-binding transcription factor DksA (dksA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06204, DnaK suppressor protein (inferred from 92% identity to pfs:PFLU5233)

Predicted SEED Role

"C4-type zinc finger protein, DksA/TraR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UC37 at UniProt or InterPro

Protein Sequence (147 amino acids)

>PS417_23875 molecular chaperone DnaK (Pseudomonas simiae WCS417)
MSTQAKQQQTQGLNGFEPYVEKKGEEYMGEPMRDHFTKILNKWKQDLMQEVDRTVDHMKD
EAANFPDPADRASQEEEFALELRARDRERKLIKKIDKTLQLIKDEEYGWCESCGVEIGIR
RLEARPTADLCVDCKTLAEIKEKQVGK