Protein Info for GFF4666 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FOG: Ankyrin repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF12796: Ank_2" amino acids 40 to 130 (91 residues), 47.5 bits, see alignment E=5.3e-16 amino acids 84 to 163 (80 residues), 53.5 bits, see alignment E=7.3e-18 amino acids 129 to 197 (69 residues), 53.4 bits, see alignment E=8e-18 amino acids 148 to 212 (65 residues), 36.9 bits, see alignment E=1.1e-12 PF13857: Ank_5" amino acids 87 to 139 (53 residues), 28.3 bits, see alignment E=4.7e-10 amino acids 154 to 208 (55 residues), 42.1 bits, see alignment E=2.2e-14 PF13606: Ank_3" amino acids 103 to 129 (27 residues), 17.4 bits, see alignment (E = 1.2e-06) amino acids 132 to 162 (31 residues), 20.3 bits, see alignment 1.4e-07 amino acids 170 to 194 (25 residues), 20.1 bits, see alignment (E = 1.6e-07) PF00023: Ank" amino acids 103 to 131 (29 residues), 18.7 bits, see alignment 4.2e-07 amino acids 132 to 163 (32 residues), 29.4 bits, see alignment 1.7e-10 amino acids 169 to 198 (30 residues), 31.7 bits, see alignment 3.1e-11 PF13637: Ank_4" amino acids 104 to 155 (52 residues), 39.9 bits, see alignment E=1e-13

Best Hits

KEGG orthology group: K06867, (no description) (inferred from 54% identity to pol:Bpro_2515)

Predicted SEED Role

"FOG: Ankyrin repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>GFF4666 FOG: Ankyrin repeat (Hydrogenophaga sp. GW460-11-11-14-LB1)
LKNFIRNMKYIKKSIVFKWIISFAALGMGAVWASSFDDFFIAIKKDDAAAVRQLAQRGFD
LNTRNPEGEHALYLAIRDDAPQVASFLLSQKPVDVEARTSKDESPLMIAAIKGKLDLARR
LIERKAEVNKTGWTPLHYAASHAGDDSTAMVRLLLEHHAYIDAESPNKTTPLMMAAHYGS
AAVVKLLLEEGADPLLKNEQGLNAIDFARKANRQASADIIAGFVRAQQPKGKW