Protein Info for PS417_23850 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 70 to 91 (22 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 161 to 185 (25 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 254 to 280 (27 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details PF01032: FecCD" amino acids 17 to 342 (326 residues), 300.2 bits, see alignment E=7.6e-94

Best Hits

Swiss-Prot: 47% identical to BTUC_SHIB3: Vitamin B12 import system permease protein BtuC (btuC) from Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 97% identity to pfs:PFLU5228)

MetaCyc: 47% identical to vitamin B12 ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-5-RXN [EC: 7.6.2.8]; 7.6.2.8 [EC: 7.6.2.8]

Predicted SEED Role

"Hemin ABC transporter, permease protein" in subsystem Hemin transport system or Iron acquisition in Vibrio or Putative hemin transporter

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UHF5 at UniProt or InterPro

Protein Sequence (345 amino acids)

>PS417_23850 ABC transporter permease (Pseudomonas simiae WCS417)
MTTLVKPKTLFVGLALLCVLAIWLSLALGPVSLPLLDTLKAALRLMGLPIEAQGLEQAEL
ILGQIRLPRTLLGLAVGGVLALSGVAMQGLFRNPLADPGLVGVSSGAALGAAVAIVGGSF
FGGLPDAFGPYLLSFCAFLGGLGVTALVYRLGRRNGQTNVATMLLAGIALTALASSAVGL
FTYLADDATLRTLTFWNLGSLNGASYSRLWPLLLVSAGVAMWLPRRAKALNALLLGESEA
NHLGIDVEGLKRELVFCTALGVGAAVAAAGMIGFVGLVVPHLVRLLAGPDHRVLLPASVL
AGASLLLFADLVARLALAPAELPIGIVTAFIGAPFFLYLLLRGRA