Protein Info for GFF4658 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 4-hydroxybenzoyl-CoA thioesterase family active site

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 13 to 126 (114 residues), 90.9 bits, see alignment E=3.6e-30 PF13279: 4HBT_2" amino acids 16 to 136 (121 residues), 48 bits, see alignment E=4.2e-16 PF03061: 4HBT" amino acids 25 to 108 (84 residues), 43.8 bits, see alignment E=6.4e-15 PF00583: Acetyltransf_1" amino acids 177 to 266 (90 residues), 37.1 bits, see alignment E=8.7e-13 PF13673: Acetyltransf_10" amino acids 185 to 285 (101 residues), 53.4 bits, see alignment E=6.6e-18 PF13508: Acetyltransf_7" amino acids 189 to 267 (79 residues), 34.3 bits, see alignment E=6.4e-12

Best Hits

KEGG orthology group: None (inferred from 68% identity to pol:Bpro_2524)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>GFF4658 4-hydroxybenzoyl-CoA thioesterase family active site (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSLTRSDFRFFHRLRVRWAEVDMQKIVFNAHYLMYFDTAMTDYWRALALPYHETMEQLEG
DLYVVKATVEFHASARVDDQIDVAMKCSRIGTSSLSFTGAIFRGDEHLISGELIYVFADP
ATQKSRPVPPALREALNGYEAGEPMSSVRVGLWSELGPDAQRLRTAVFVEEQRIPKELEW
DEADAVALHAVAYNRLGRAVATGRMLPHEPGVARIGRMAVERSLRGGRLGRDVLHALMGA
ARERGDAEVMLHAQRSAEGFYTRLGFERRGEAFEEAGIPHQEMIAKL