Protein Info for GFF4655 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868
Annotation: 18K peptidoglycan-associated outer membrane lipoprotein; Peptidoglycan-associated lipoprotein precursor; Outer membrane protein P6; OmpA/MotB precursor
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 96% identical to PAL_ECOLI: Peptidoglycan-associated lipoprotein (pal) from Escherichia coli (strain K12)
KEGG orthology group: K03640, peptidoglycan-associated lipoprotein (inferred from 99% identity to sea:SeAg_B0785)Predicted SEED Role
"18K peptidoglycan-associated outer membrane lipoprotein; Peptidoglycan-associated lipoprotein precursor; Outer membrane protein P6; OmpA/MotB precursor"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (174 amino acids)
>GFF4655 18K peptidoglycan-associated outer membrane lipoprotein; Peptidoglycan-associated lipoprotein precursor; Outer membrane protein P6; OmpA/MotB precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868) MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGGMLNGAGTGMDANGNGNMSSEEQAR LQMQQLQQNNIVYFDLDKYDIRSDFAAMLDAHANFLRSNPSYKVTVEGHADERGTPEYNI SLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYAKNRRAVLVY