Protein Info for GFF465 in Variovorax sp. SCN45

Annotation: Prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 207 to 224 (18 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 2 to 261 (260 residues), 260.2 bits, see alignment E=1.2e-81 PF01790: LGT" amino acids 7 to 261 (255 residues), 271.9 bits, see alignment E=2.2e-85

Best Hits

Swiss-Prot: 76% identical to LGT_POLSJ: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 96% identity to vpe:Varpa_3396)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-, 2.4.99.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>GFF465 Prolipoprotein diacylglyceryl transferase (Variovorax sp. SCN45)
MYPQINPIALQLGPVAIHWYGLTYLAAFALFYFLGTRRLRHEPYRSLVGAGAWQRKDIED
ILFLGVMGVIVGGRLGYCLFYKPEFYLTHPLEILYVWQGGMSFHGGLLGVIGAMVWFSHS
RARPFWQVMDFVAPCVPTGLAAGRVGNFINGELWGRFSSPDLPWGMVFPQSGSMLPRHPS
QVYQFLLEGLLLFAIMWIYARKERKQGQVASVFLIGYGALRFIAEYFREPDDFLGLRALS
LSQGQWLSVPMVIAGIALWFWFGRGGKTAATARA