Protein Info for GFF4649 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Transcription accessory protein (S1 RNA-binding domain)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 822 PF09371: Tex_N" amino acids 41 to 233 (193 residues), 219.2 bits, see alignment E=1.1e-68 PF16921: Tex_YqgF" amino acids 376 to 505 (130 residues), 170.4 bits, see alignment E=6.8e-54 PF14635: HHH_7" amino acids 518 to 610 (93 residues), 32 bits, see alignment E=4e-11 PF12836: HHH_3" amino acids 545 to 609 (65 residues), 91.5 bits, see alignment E=9.2e-30 PF17674: HHH_9" amino acids 615 to 684 (70 residues), 82.3 bits, see alignment E=1.1e-26 PF00575: S1" amino acids 703 to 774 (72 residues), 72.1 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 83% identity to dia:Dtpsy_1997)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (822 amino acids)

>GFF4649 Transcription accessory protein (S1 RNA-binding domain) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVETGQAPTTNSADGSPNGCGKLARFLFSHRRCMQQIIRQIATEIRVEERQVQAAVELLD
GGATVPFIARYRKEVTGGLDDIQLRELSYRLDYLRELEDRRAAVLKSIDEQGKLTDALRA
AIAAVPTKQELEDLYLPFKQKRRTKGQIAREFGIEPLADKLFADPTLDPSTEAAAFTRPP
EVLDDGKPGADFSTVPAVLDGVRDILSERWAEDPSLVQNLREWLWSEGLLKSTLVNGKDE
NAPEVAKFRDYFEYDEPIARVPSHRALAVFRGRGLEILDAKLVLPEPPDAVPAGKPGATP
SLAEGRIALHLGWSHKARAADDLLRKCMAWTWRVKLSLSSERDLFARLRESAEAVAIKVF
ADNLRDLLLAAPAGPKVVMGLDPGIRTGVKVAVVDATGKLVDTATVYPHEPRRDWDGALH
TLALLGRKHGVNLIAIGNGTASRETDKLAADLIKLLEKANLTGVQKVVVSEAGASVYSAS
EFASQEMPDVDVSLRGAASIARRLQDPLAELVKIDPKSIGVGQYQHDVNQSELARTLEAV
VEDCVNGVGVDLNTASVPLLSRVSGLSGSVAKAVVRWRETNGAFKSRQQLMDVAGLGAKT
FEQSAGFLRIRGGDNPLDMTGVHPETYAVVEQIMEKTGKPVAELMGRADMLKTLRPELFA
NERFGVITVKDILGELEKPGRDPRPDFQVARFNEGVDDISDLREGMVLEGTVSNVAQFGA
FVDLGVHQDGLVHVSQLSHKFVNDAREIVKTGDIVKVKVMEVDVARKRIGLSMKLDAAPA
RRDGPRDNRYEPSRGQGRASGPASPPAPSAMASAFAKLKRNP