Protein Info for PS417_23745 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 54 (23 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 264 to 281 (18 residues), see Phobius details PF00892: EamA" amino acids 6 to 132 (127 residues), 40.2 bits, see alignment E=2.1e-14 amino acids 145 to 278 (134 residues), 50.8 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU5207)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UHD1 at UniProt or InterPro

Protein Sequence (282 amino acids)

>PS417_23745 hypothetical protein (Pseudomonas simiae WCS417)
MENSDIAITLVLISAFMHATWNAVVRAGSSRFMTLAMVDGTALVICLLALPLVSVPSLEV
GGYILVSVVLNTVYRLFLIKAYETGDFGQVYPVMRGVPPVLVALFSYFLLHEQLSVQALV
GVSLICVGIISLTFVRRMTAQMFKPILMAVCAGAFIASYTVVDAKGVRTSETVLQYIVYL
TVFQSIPIPLLAFSKERSALAQAIRGHWRVGLLGGVFYLASYALVLFALSLDAVAKVSAL
RETSVIIGAIIAALFFHERFGWRRMLSAFVIVSGIILIKVST