Protein Info for GFF4638 in Xanthobacter sp. DMC5

Annotation: Disulfide-bond oxidoreductase YfcG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF02798: GST_N" amino acids 3 to 77 (75 residues), 46 bits, see alignment E=1.6e-15 PF13417: GST_N_3" amino acids 6 to 79 (74 residues), 32.5 bits, see alignment E=2.6e-11 PF13409: GST_N_2" amino acids 14 to 78 (65 residues), 38.8 bits, see alignment E=3.6e-13 PF00043: GST_C" amino acids 121 to 194 (74 residues), 39.1 bits, see alignment E=2.1e-13 PF14497: GST_C_3" amino acids 124 to 195 (72 residues), 29.7 bits, see alignment E=1.8e-10 PF13410: GST_C_2" amino acids 130 to 187 (58 residues), 34 bits, see alignment E=7.6e-12

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 59% identity to ret:RHE_CH01216)

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) / Glutathione S-transferase" in subsystem Gentisare degradation or Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 5.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18, 5.2.1.2

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>GFF4638 Disulfide-bond oxidoreductase YfcG (Xanthobacter sp. DMC5)
VSPFKLYCFAQSGNAYRAALMLELCGLAWEARFVDYFNGETRTEDYKRDVNEMGEVPVLV
DGELKLSQSGVILDYLAKKTGRFLPDDEAGRREVLRWILFDNHKFTSYFATLRFMVGLRG
EGENELTAFLRTRASAAYAVADRHLQASDFLVGDRPTIADISLAGYIYYPERAGVVVEDY
PALARWAGRIAALPGWKAPYELMPGHPLALAETP