Protein Info for GFF4637 in Sphingobium sp. HT1-2

Annotation: 4-hydroxybutyrate coenzyme A transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 60 to 78 (19 residues), see Phobius details PF02550: AcetylCoA_hydro" amino acids 107 to 193 (87 residues), 27.2 bits, see alignment E=3.8e-10 PF13336: AcetylCoA_hyd_C" amino acids 285 to 436 (152 residues), 215.6 bits, see alignment E=3.3e-68

Best Hits

KEGG orthology group: None (inferred from 74% identity to ara:Arad_7046)

Predicted SEED Role

"4-hydroxybutyrate:acetyl-CoA CoA transferase (EC 2.3.1.-)" (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>GFF4637 4-hydroxybutyrate coenzyme A transferase (Sphingobium sp. HT1-2)
MTPKGDQALYQQTRRSAQEAAALIPSGAKICMALGTGQPPSLLAALAERARSGSVADLRI
YYMLCTGIAGASVFDFALRDRITPMSLFHGGVERTLDRQHGDAHLPMVDFLPCHFSQVPR
AMVEHVGVDTLIATVAPMDADGNFSLGTDVDYALAVARKPGTRIILEVNAHMPYVQGDCM
IPLSAVTALVEHDVALPTLPAITRTAVDDAIGATVAGLIRDGDCLQMGIGALPEAVCAGL
ANHRHLGIHTEMMTTGLAGLMQSGVVDNSRKQIHAGKAIYTFALGDQALYDFLHDNPAVE
AHPVDYVNNPFLIARNDNMVSVNATLQVDFHGACNSEFVNGRQFSGTGGQVDFVRGAYAS
RGGRSIIACHSTAAKGTISRITPRLDGPVTTPRMDTHLIVTEYGLADLKGKSVGERAKAL
IAIAHPDFREQLERAAFDAGLFAG