Protein Info for GFF4634 in Xanthobacter sp. DMC5

Annotation: O-succinylhomoserine sulfhydrylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 56% identical to METZ_MYCTO: O-succinylhomoserine sulfhydrylase (metZ) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K10764, O-succinylhomoserine sulfhydrylase [EC: 2.5.1.-] (inferred from 90% identity to xau:Xaut_0471)

MetaCyc: 45% identical to MdeA (Pseudomonas putida)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

superpathway of branched chain amino acid biosynthesis (17/17 steps found)
aspartate superpathway (22/25 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
L-methionine degradation II (3/3 steps found)
L-threonine degradation I (5/6 steps found)
L-homocysteine biosynthesis (2/2 steps found)
L-methionine biosynthesis III (3/4 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
L-methionine biosynthesis II (4/6 steps found)
superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
superpathway of L-homoserine and L-methionine biosynthesis (5/8 steps found)
superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)
L-methionine biosynthesis I (2/5 steps found)
homocysteine and cysteine interconversion (1/4 steps found)
superpathway of L-threonine metabolism (11/18 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (1/5 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (1/5 steps found)
hypoglycin biosynthesis (4/14 steps found)
superpathway of seleno-compound metabolism (5/19 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 2.5.1.48, 2.5.1.49

Use Curated BLAST to search for 2.5.1.- or 2.5.1.48 or 2.5.1.49 or 4.4.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>GFF4634 O-succinylhomoserine sulfhydrylase (Xanthobacter sp. DMC5)
MSVAPKPTPRFVPRDPLTLHPETRLVHGGTTRSPFGETSEALFLTQGFVYDDAESCEARF
KGEDPGFVYSRYSNPTTAMFEERMALLEGAEAARATASGMAAVNAALLCQLSAGDHVLAA
RALFGSCRWILEDFLPRFGVETTLIDGGDLEAWKAGVKPNTKILFLESPTNPTLDLIDIA
AVAEIAHAAGARLVVDNVFATPLLQHPFELGADVVVYSTTKHVDGQGRCLGGVILSSKQF
VTDHLQTFLRQTGPSISPFNAWIMLKGLETLALRVERMQASAGKVADALAALPGVEKVIY
PGRADHPQAELAKRQMKGGGTLVTFVVKDGKEGAFRFANALRLIRISNNLGDAKSLITHP
ATTTHQRFTPETRAEMGISDGLLRLSVGLEHADDLIADLAGAAEAL