Protein Info for PS417_23705 in Pseudomonas simiae WCS417

Updated annotation (from data): Tryptophan 2,3-dioxygenase (EC 1.13.11.11)
Rationale: Specifically important for utilizing L-Tryptophan. Automated validation from mutant phenotype: the predicted function (RXN-8665) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: tryptophan 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF03301: Trp_dioxygenase" amino acids 17 to 181 (165 residues), 137.1 bits, see alignment E=4.9e-44 amino acids 210 to 285 (76 residues), 87.1 bits, see alignment E=8.1e-29 TIGR03036: tryptophan 2,3-dioxygenase" amino acids 22 to 285 (264 residues), 423.9 bits, see alignment E=1.2e-131

Best Hits

Swiss-Prot: 88% identical to T23O_PSEF5: Tryptophan 2,3-dioxygenase (kynA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K00453, tryptophan 2,3-dioxygenase [EC: 1.13.11.11] (inferred from 99% identity to pfs:PFLU5198)

MetaCyc: 43% identical to tryptophan 2,3-dioxygenase (Streptomyces anulatus)
Tryptophan 2,3-dioxygenase. [EC: 1.13.11.11, 1.13.11.52]

Predicted SEED Role

"Tryptophan 2,3-dioxygenase (EC 1.13.11.11)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 1.13.11.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.11 or 1.13.11.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UNF9 at UniProt or InterPro

Protein Sequence (285 amino acids)

>PS417_23705 Tryptophan 2,3-dioxygenase (EC 1.13.11.11) (Pseudomonas simiae WCS417)
MSQCPFSADYQPPEEWHNAELNFSESMSYGDYLDLGKVLSAQHPLSPDHNEMLFIIQHQT
SELWMKLMLHELKAAREHVRLGELPPAFKMLARVSRIFDQLVHAWAVLATMTPSEYKSIR
PFLGQSSGFQSFQYREIEFILGNKSAALLRPHAHRPELLNELKVAIATPSLYDEAINLMI
QAGLAIDPKRAERDPTAATVHDESVEAAWREVYRDPSRYWDLYQLAEKFIDLEDSFRQWR
FRHVTTVERIIGFQPGTGGTEGVGYLRKMLDTVLFPELWRVRSTL