Protein Info for PS417_23695 in Pseudomonas simiae WCS417

Updated annotation (from data): electron transfer component of the anthranilate 1,2-dioxygenase system (EC 1.14.12.1)
Rationale: Specifically important in carbon source L-Tryptophan. Tryptophan is catabolized via kynurenine and anthranilate, so this system acts on anthranilate, not benzoate. The subunits of the other component are PS417_23685 and PS417_23690.
Original annotation: anthranilate dioxygenase reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00111: Fer2" amino acids 10 to 85 (76 residues), 63.8 bits, see alignment E=1.7e-21 PF00970: FAD_binding_6" amino acids 110 to 199 (90 residues), 63.9 bits, see alignment E=2.2e-21 PF00175: NAD_binding_1" amino acids 209 to 312 (104 residues), 73.8 bits, see alignment E=2.6e-24

Best Hits

Swiss-Prot: 61% identical to ANTDC_ACIAD: Anthranilate 1,2-dioxygenase electron transfer component (antC) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K11311, anthranilate dioxygenase reductase (inferred from 94% identity to pfs:PFLU5196)

MetaCyc: 61% identical to anthranilate dioxygenase reductase component (Acinetobacter baylyi ADP1)
Anthranilate 1,2-dioxygenase (deaminating, decarboxylating). [EC: 1.14.12.1]

Predicted SEED Role

"benzoate dioxygenase, ferredoxin reductase component; Anthranilate dioxygenase reductase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.1

Use Curated BLAST to search for 1.14.12.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UHC1 at UniProt or InterPro

Protein Sequence (335 amino acids)

>PS417_23695 electron transfer component of the anthranilate 1,2-dioxygenase system (EC 1.14.12.1) (Pseudomonas simiae WCS417)
MNHKVAFSFADGKTLFFPVGANEILLDAALRNGIKIPLDCREGVCGTCQGRCESGDYSQD
YVDEEALSSLDLQQRKMLSCQTRVKSDATFYFDFDSSLCNAPGPVQVKGTVSAVEQVSAS
TAILQVQLDQALDFLPGQYARLSVPGTDSWRSYSFANLPGNHLQFLVRLLPDGVMSNYLR
ERCQVGDELLMEAPLGAFYLRHVTQPLVLVAGGTGLSALLGMLDQLAANGCEQPVHLYYG
VRGAEDLCEAARIRAYAAKIPNLRYTEVLSAPSEEWSGKRGYLTEHFDLAELRDGSADMY
LCGPPPMVESIQQWLADQALDGVQLYYEKFTQSNI