Protein Info for GFF4630 in Xanthobacter sp. DMC5

Annotation: Riboflavin transporter RfnT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 174 to 199 (26 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 241 to 266 (26 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details amino acids 338 to 360 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 89% identity to xau:Xaut_0467)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>GFF4630 Riboflavin transporter RfnT (Xanthobacter sp. DMC5)
MLVCVCDPQLDAPANDNGPRAVSTFGLAVGFAFAVLAQTVASAALPLAGAQLAPRPELVT
WPFAALLLGAALASFPASFLRDAFGRRTGFALGASVGIAGGALLVAALIQRQFAWACLGA
LWLGMAQGFSFFYRHEAAAASGRPAAATAGVLAGGLLAAVAGPTLAGFAESLAAPFFLVG
AAALAALAHTCSLGVAVMLADDPTSTFRPKVTAPLSAIVWPTLVAGTAWFGMNAVMSGAP
LALVGCGIGGAAVFGFIALHVAAMYAPAVPLALAGDRLPPLAIALTGVVLVAIGVPLQRL
ATPESITAALICVGAGWSVATVGATAWIYQSGQPSRLALALHDGGLFALAICGALTGYLL
A