Protein Info for GFF4625 in Xanthobacter sp. DMC5

Annotation: Cbb3-type cytochrome c oxidase subunit FixP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details TIGR00782: cytochrome c oxidase, cbb3-type, subunit III" amino acids 11 to 292 (282 residues), 402.2 bits, see alignment E=5.9e-125 PF14715: FixP_N" amino acids 17 to 62 (46 residues), 85.3 bits, see alignment 2.8e-28 PF00034: Cytochrom_C" amino acids 116 to 202 (87 residues), 46.9 bits, see alignment E=8.4e-16 amino acids 212 to 289 (78 residues), 35.1 bits, see alignment E=4e-12 PF13442: Cytochrome_CBB3" amino acids 116 to 198 (83 residues), 46 bits, see alignment E=8.1e-16 amino acids 210 to 286 (77 residues), 48.3 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 70% identical to FIXP_AZOC5: Cbb3-type cytochrome c oxidase subunit FixP (fixP) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K00406, cb-type cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 89% identity to xau:Xaut_0462)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>GFF4625 Cbb3-type cytochrome c oxidase subunit FixP (Xanthobacter sp. DMC5)
VSTTNDTHGKVDQATGVSTTGHEWDGISELNNPLPRWWLWVWYACIVWAIGYWILYPAWP
LVSSATPGLLGWHSRSAVAVQIADLNAIRSESAAKLANASLEQIEQTPALLSLARAQGRV
AFADNCAPCHGAGGGGATGFPNLNDDDWLWGGSLEQIQQTIEHGIRANDPDTRQGNMPAF
GKDGILQKPEISAVADYVRTLSGIAKPGADYDKGKEVFASNCAACHGDDGKGNQEMGAPN
LTDGIWLYGSDKATIEYGVINGRGNVMPSWHARLDPTTIKALTVYVHSLGGGR