Protein Info for PS417_23665 in Pseudomonas simiae WCS417

Updated annotation (from data): Muconolactone isomerase (EC 5.3.3.4)
Rationale: Specifically important for utilizing L-Tryptophan. Automated validation from mutant phenotype: the predicted function (MUCONOLACTONE-DELTA-ISOMERASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: muconolactone delta-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 PF02426: MIase" amino acids 1 to 89 (89 residues), 132 bits, see alignment E=3.6e-43 TIGR03221: muconolactone delta-isomerase" amino acids 2 to 91 (90 residues), 154.6 bits, see alignment E=2.9e-50

Best Hits

Swiss-Prot: 77% identical to CATC_PSEPU: Muconolactone Delta-isomerase (catC) from Pseudomonas putida

KEGG orthology group: K03464, muconolactone D-isomerase [EC: 5.3.3.4] (inferred from 94% identity to pfs:PFLU5191)

MetaCyc: 84% identical to muconolactone isomerase (Pseudomonas reinekei)
Muconolactone Delta-isomerase. [EC: 5.3.3.4]

Predicted SEED Role

"Muconolactone isomerase (EC 5.3.3.4)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 5.3.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3T5 at UniProt or InterPro

Protein Sequence (96 amino acids)

>PS417_23665 Muconolactone isomerase (EC 5.3.3.4) (Pseudomonas simiae WCS417)
MLFHVKMTVNLPLDMNPERAAGLKAEEKALAQRLQQEGKWRHLWRIAGHYANYSVFDVDS
VQELHDLLMQLPLYPYMAIEVNALCRHPSSIHEDDR