Protein Info for GFF4625 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 50 to 73 (24 residues), see Phobius details amino acids 120 to 125 (6 residues), see Phobius details PF13477: Glyco_trans_4_2" amino acids 3 to 119 (117 residues), 56.3 bits, see alignment E=8.4e-19 PF13439: Glyco_transf_4" amino acids 21 to 175 (155 residues), 28.6 bits, see alignment E=2.8e-10 PF00534: Glycos_transf_1" amino acids 185 to 353 (169 residues), 105.8 bits, see alignment E=3.8e-34 PF13692: Glyco_trans_1_4" amino acids 196 to 339 (144 residues), 72.1 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to spt:SPA2021)

Predicted SEED Role

"Putative glycosyl transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>GFF4625 Putative glycosyl transferase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKRLCYFVNSDWYFDLHWTERAIAARDAGYEIHIISHFIGEEIIKKFKTLGFICHNVSLV
AQSFNMFVFFRAFLNARKIIKEINPDLLHCITLKPCLIGGVSARRSNSPVVISFVGLGRI
FLYNTVPMRILRALTVLVYKYIAGNKRGVFIFEHDKDRRKISRLVGIDYHKTIVIEGAGI
NPDIYKFSIEKKHEIPIVLFASRMLWSKGLGDLIEAKKILRQKNIHFVLNVAGILAEDDK
DAIPLELIHHWHNEGLINWLGRSSNVYELIQKSNIVALPSIYPEGVPRLLLEASSVGRAC
IAYDTGGCDSLIIHNYNGLIVKSNSAQELAVELEYLLKNPQIRLEMGANGRKRVKELFSS
ILVINKTLQIYKDTIGC