Protein Info for GFF4623 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details TIGR00781: cytochrome c oxidase, cbb3-type, subunit II" amino acids 12 to 244 (233 residues), 348.8 bits, see alignment E=7.5e-109 PF02433: FixO" amino acids 12 to 237 (226 residues), 327.9 bits, see alignment E=1.4e-102

Best Hits

KEGG orthology group: K00405, cb-type cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 87% identity to xau:Xaut_0460)

MetaCyc: 63% identical to cytochrome cbb3 oxidase subunit II (Rhodobacter capsulatus)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase subunit CcoO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>GFF4623 hypothetical protein (Xanthobacter sp. DMC5)
MATQGTSIWSKHQIFEKHSYWLMLGILVMISIGGLVEIAPLFYLKSTIEKVEGMRPYTPL
ELAGRNIYVREGCYNCHSQMIRPLRDEVERYGHYSLAAESMYDRPFQWGSKRTGPDLARV
GGKYSDLWQVEHLNNPRSVVPASIMPSYPWLAKTRLNAKHIGEEMRVQQVLGVPYTDEMI
AKAQDDLKTQATTDAADSDGLQKRYPKAQGRDYDGNPGELTEADALIAYLQMLGTLVDFK
LYDNQANVR