Protein Info for PS417_23650 in Pseudomonas simiae WCS417

Updated annotation (from data): Kynureninase (EC 3.7.1.3)
Rationale: Specifically important for utilizing L-Tryptophan. Automated validation from mutant phenotype: the predicted function (KYNURENINASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: kynureninase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR01814: kynureninase" amino acids 7 to 400 (394 residues), 362.5 bits, see alignment E=1.3e-112 PF00266: Aminotran_5" amino acids 76 to 350 (275 residues), 58.9 bits, see alignment E=6.7e-20 PF22580: KYNU_C" amino acids 306 to 395 (90 residues), 138.4 bits, see alignment E=9.8e-45

Best Hits

Swiss-Prot: 86% identical to KYNU_PSEFL: Kynureninase (kynU) from Pseudomonas fluorescens

KEGG orthology group: K01556, kynureninase [EC: 3.7.1.3] (inferred from 96% identity to pfs:PFLU5188)

MetaCyc: 86% identical to kynureninase subunit (Pseudomonas fluorescens)
Kynureninase. [EC: 3.7.1.3]

Predicted SEED Role

"Kynureninase (EC 3.7.1.3)" in subsystem NAD and NADP cofactor biosynthesis global (EC 3.7.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8U5 at UniProt or InterPro

Protein Sequence (416 amino acids)

>PS417_23650 Kynureninase (EC 3.7.1.3) (Pseudomonas simiae WCS417)
MTTRSHCQALDAQDPLAPLRSQFALPEGVIYLDGNSLGARPVAALARAQAVIAEEWGNGL
IRSWNNAGWADLSLRLGNRLAPLIGARDNEVAITDTTSINLFKVLSAALTVQRQRQPGRK
VIVSEASNFPTDLYIAEGLAELLQQGYSLRLVNSPDELPQAIDQDVAVVMLTHVNYKTGY
MYDMQALTALSHECGALSIWDLAHSAGAVPIDLHQAGADYAIGCTYKYLNGGPGSQAFVW
VNPALVDVVRQPLSGWFGHTRQFAMESTYAPSAGIARYLCGTQPITSLAMVECGLEIFAQ
TDMASLRSKSLALTDLFIALVEARCAAHDLKLITPREHAKRGSHVSFEHPEGYAVIQALI
ARGVIGDYREPRIMRFGFTPLYTRFTEVWEAVEILGDILDNHTWNQPQFKVRNSVT