Protein Info for GFF4615 in Sphingobium sp. HT1-2

Annotation: Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.8.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 12 to 123 (112 residues), 115.1 bits, E=5.5e-37
• PF02770: Acyl-CoA_dh_M
  • amino acids 128 to 223 (96 residues), 81.2 bits, E=1.2e-26
• PF00441: Acyl-CoA_dh_1
  • amino acids 235 to 383 (149 residues), 169 bits, E=2e-53
• PF22924: ACOX_C_alpha1
  • amino acids 247 to 382 (136 residues), 29.8 bits, E=1.2e-10
• PF08028: Acyl-CoA_dh_2
  • amino acids 250 to 372 (123 residues), 85.7 bits, E=9e-28

Best Hits

Swiss-Prot: 45% identical to ACDB_BACSU: Acyl-CoA dehydrogenase (mmgC) from Bacillus subtilis (strain 168)

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 79% identity to pzu:PHZ_c2365)

MetaCyc: 58% identical to short-chain acyl-CoA dehydrogenase monomer (Pseudomonas putida KT2440)
RXN-13449 [EC: 1.3.8.1]

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

• oleate β-oxidation (28/35 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (7/10 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• β-alanine biosynthesis II (3/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• valproate β-oxidation (5/9 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-, 1.3.99.2

Use Curated BLAST to search for 1.3.8.1 or 1.3.99.- or 1.3.99.2

Protein Sequence (383 amino acids)

>GFF4615 Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.8.1) (Sphingobium sp. HT1-2)
MSIGETQGFMPTEIQSAIRDTVRDFAQATIRPHSARFEAEGGYPRSLFEEMAGLGLWGMT
APEAYGGAEADSVSYALALMELAAADGALSTIVSIQNSILVSGLLKDGSEEQKARFLPDL
IGGRTIGAFALTESDAGSDASAVRTRAVKVDGGWRITGAKQFITSGKIGGVVMIVAVTDP
DAGKKGLSVFLVPTDRPGYAVDKVEHKMGQGASDTCALRFDDMFVEDDLLIGQPGQGYAQ
ALANLETGRIGIAAQCVGMAQAALEIAIAYAKDRKSFGKAIIEHQAVGFRLADLATRLEA
ARQLVLSAAAMKDSGQPALTQASMAKLFASEAAEAVVSGAMQTLGGYGYLEEFGIAKIYR
DVRVCQIYEGTSDIQRMVIARSL