Protein Info for GFF4613 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Zinc transporter, ZIP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 19 to 22 (4 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details PF02535: Zip" amino acids 3 to 103 (101 residues), 36 bits, see alignment E=2.4e-13 amino acids 95 to 250 (156 residues), 84.5 bits, see alignment E=4.3e-28

Best Hits

KEGG orthology group: None (inferred from 86% identity to pol:Bpro_2494)

Predicted SEED Role

"Zinc transporter, ZIP family" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF4613 Zinc transporter, ZIP family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLLASILLASLLGGVLSVIVAGFLLKGLPHYWLPRMVGFSAGLLLGAAMLSVLPEAFESG
ADAHTLFTVLLAGFIGFYALQRTTLWRHSHSAPEEGHQPTHTHTHGLGRESVLTVLIGDG
FHNFVDGVLIAAAFLTDPALGWATAIAVIAHEIPQEAGDFVLLLSSGLSFRRALVLNALS
GLASVLGALVGYLFLSHAQAFLPYALVLAAAGFIYIAIADLLPYLRREPAGMQIAWQTAA
LAAGLGAAVLLSASHG