Protein Info for GFF4609 in Xanthobacter sp. DMC5

Annotation: GMP synthase [glutamine-hydrolyzing]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain" amino acids 12 to 201 (190 residues), 238.2 bits, see alignment E=4.6e-75 PF00117: GATase" amino acids 13 to 197 (185 residues), 154.1 bits, see alignment E=9.2e-49 PF07722: Peptidase_C26" amino acids 76 to 180 (105 residues), 37 bits, see alignment E=8.2e-13 TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain" amino acids 210 to 522 (313 residues), 481.2 bits, see alignment E=1.4e-148 PF02540: NAD_synthase" amino acids 220 to 253 (34 residues), 24.7 bits, see alignment (E = 3e-09) PF03054: tRNA_Me_trans" amino acids 226 to 259 (34 residues), 23.6 bits, see alignment (E = 9.4e-09) PF00958: GMP_synt_C" amino acids 430 to 521 (92 residues), 143 bits, see alignment E=6.1e-46

Best Hits

Swiss-Prot: 80% identical to GUAA_OLICO: GMP synthase [glutamine-hydrolyzing] (guaA) from Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 95% identity to xau:Xaut_0445)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (522 amino acids)

>GFF4609 GMP synthase [glutamine-hydrolyzing] (Xanthobacter sp. DMC5)
MTAAPATSQDTVLIIDFGSQVTQLIARRVREDGVYSEVVPFQKAEEAIARLKPKAIILSG
GPASVIEGQSPKAPDAAFGAGVPVLGICYGEQCMAAQLGGAVEAGHHREFGRAEVTVQKS
VPLFEGVWRPGERHTVWMSHGDRVTRLPEGFEVVATSENAPFAAIADVSRNYYGVQFHPE
VVHTPDGARLLSNFVRKVAGLEGTWTMGAFRERAIARIREQVGTGRVICGLSGGVDSSVA
AVLIHEAIGDQLTCVFVDHGLMRQAEADEVVSLFRGHYNIPLVHVDAAELFLKELEGVED
PEVKRKTIGRLFIDVFDAEAKKVGGADFLAQGTLYPDVIESVSFAGGPSVTIKSHHNVGG
LPDRMNMKLVEPLRDLFKDEVRALGRELGLPESFVGRHPFPGPGLAIRCPGAVTQEKLDI
LRKADAIYLEEIRYAGLYDVIWQAFAVLLPVRTVGVMGDGRTYDHVLALRAVTSVDGMTA
DFYPFDMTFLGRTATRIINEVKGVNRVVYDVTSKPPGTIEWE